Registration Dossier
Registration Dossier
Please be aware that this old REACH registration data factsheet is no longer maintained; it remains frozen as of 19th May 2023.
The new ECHA CHEM database has been released by ECHA, and it now contains all REACH registration data. There are more details on the transition of ECHA's published data to ECHA CHEM here.
Use of this information is subject to copyright laws and may require the permission of the owner of the information, as described in the ECHA Legal Notice.
EC number: 945-100-3 | CAS number: -
Substance identity
Identification
- Display Name:
- SAR341402 fusion protein from E.coli (K12 Hoe I35 - plasmid pINTgeni 312) fermentation with subsequent homogenisation
- Molecular formula:
- Not applicable (UVCB substance)
- IUPAC Name:
- SAR341402 fusion protein from E.coli (K12 Hoe I35 - plasmid pINTgeni 312) fermentation with subsequent homogenisation
Type of Substance
- Composition:
- UVCB
- Origin:
- other: biological (UVCB sub type 3)
Substance Identifiers open all close all
Compositions
Boundary Composition(s)
Legal Entity Composition(s) open all close all
- State Form:
- solid: bulk
Constituent 1
- Reference substance name:
- L-Alanyl-L-threonyl-L-threonyl-L-seryl-L-threonyl-L-leucyl-L-threonyl-L-threonyl-L-histidyl-L tryptophanyl-L-histidyl-L-tryptophanyl-L-histidyl-glycyl-L-asparaginyl-L-seryl-L-alanyl-L-arginyl-L phenylalanyl-L-valyl-L-asparaginyl-L-glutaminyl-L-histidyl-L-leucyl-L-cysteinyl-glycyl-L-seryl-L histidyl-L-leucyl-L-valyl-L-glutamyl-L-alanyl-L-leucyl-L-tyrosyl-L-leucyl-L-valyl-L-cysteinyl-glycyl-L glutamyl-L-arginyl-glycyl-L-phenylalanyl-L-phenylalanyl-L-tyrosyl-L-threonyl-L-aspartyl-L-lysyl-L threonyl-L-arginyl-glycyl-L-isoleucyl-L-valyl-L-glutamyl-L-glutaminyl-L-cysteinyl-L-cysteinyl-L threonyl-L-seryl-L-isoleucyl-L-cysteinyl-L-seryl-L-leucyl-L-tyrosyl-L-glutaminyl-L-leucyl-L-glutamyl-L-asparaginyl-L-tyrsoyl-L-cysteinyl-L-asparagine SAR341402 fusion protein from E.coli (K12 Hoe I35 - plasmid pINTgeni 312) fermentation with subsequent homogenisation, washing and concentration
- Molecular formula:
- Primary sequence: ATTSTLTTHWHWHGNSARFVNQHLCGSHLVEALYLVCGERGFFYTDKTRGIVEQCCTSICSLYQLENYCN Sum formula: C352H525N99O105S6
- IUPAC Name:
- L-Alanyl-L-threonyl-L-threonyl-L-seryl-L-threonyl-L-leucyl-L-threonyl-L-threonyl-L-histidyl-L tryptophanyl-L-histidyl-L-tryptophanyl-L-histidyl-glycyl-L-asparaginyl-L-seryl-L-alanyl-L-arginyl-L phenylalanyl-L-valyl-L-asparaginyl-L-glutaminyl-L-histidyl-L-leucyl-L-cysteinyl-glycyl-L-seryl-L histidyl-L-leucyl-L-valyl-L-glutamyl-L-alanyl-L-leucyl-L-tyrosyl-L-leucyl-L-valyl-L-cysteinyl-glycyl-L glutamyl-L-arginyl-glycyl-L-phenylalanyl-L-phenylalanyl-L-tyrosyl-L-threonyl-L-aspartyl-L-lysyl-L threonyl-L-arginyl-glycyl-L-isoleucyl-L-valyl-L-glutamyl-L-glutaminyl-L-cysteinyl-L-cysteinyl-L threonyl-L-seryl-L-isoleucyl-L-cysteinyl-L-seryl-L-leucyl-L-tyrosyl-L-glutaminyl-L-leucyl-L-glutamyl-L-asparaginyl-L-tyrsoyl-L-cysteinyl-L-asparagine SAR341402 fusion protein from E.coli (K12 Hoe I35 - plasmid pINTgeni 312) fermentation with subsequent homogenisation, washing and concentration
Constituent 2
- Reference substance name:
- not applicable (unknown proteins with a mass of 3 kDa - 9 kDa of SAR341402-Fusionproteine)
- Molecular formula:
- not applicable (unknown proteins with a mass of 3 kDa - 9 kDa of SAR341402-Fusionproteine)
- IUPAC Name:
- not applicable (unknown proteins with a mass of 3 kDa - 9 kDa of SAR341402-Fusionproteine)
Constituent 3
- Reference substance name:
- not applicable (unknown proteins with a mass of 9 kDa - 16 kDa of SAR341402-Fusionproteine)
- Molecular formula:
- not applicable (unknown proteins with a mass of 9 kDa - 16 kDa of SAR341402-Fusionproteine)
- IUPAC Name:
- not applicable (unknown proteins with a mass of 9 kDa - 16 kDa of SAR341402-Fusionproteine)
Constituent 4
- Reference substance name:
- not applicable (unknown proteins with a mass of 16 kDa - 29 kDa of SAR341402-Fusionproteine)
- Molecular formula:
- not applicable (unknown proteins with a mass of 16 kDa - 29 kDa of SAR341402-Fusionproteine)
- IUPAC Name:
- not applicable (unknown proteins with a mass of 16 kDa - 29 kDa of SAR341402-Fusionproteine)
Constituent 5
- Reference substance name:
- not applicable (unknown proteins with a mass of 29 kDa - 70 kDa of SAR341402-Fusionproteine)
- Molecular formula:
- not applicable (unknown proteins with a mass of 29 kDa - 70 kDa of SAR341402-Fusionproteine)
- IUPAC Name:
- not applicable (unknown proteins with a mass of 29 kDa - 70 kDa of SAR341402-Fusionproteine)
Constituent 6
- Reference substance name:
- not applicable (unknown proteins without a specific mass of SAR341402-Fusionproteine)
- Molecular formula:
- not applicable (unknown proteins without a specific mass of SAR341402-Fusionproteine)
- IUPAC Name:
- not applicable (unknown proteins without a specific mass of SAR341402-Fusionproteine)
Constituent 7
- Reference substance name:
- m-cresol
- EC Number:
- 203-577-9
- EC Name:
- m-cresol
- CAS Number:
- 108-39-4
- Molecular formula:
- C7H8O
- IUPAC Name:
- 3-Methylphenol
Composition(s) generated upon use
Other types of composition(s)
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice.
Reproduction or further distribution of this information may be subject to copyright protection. Use of the information without obtaining the permission from the owner(s) of the respective information might violate the rights of the owner.
